PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_130918g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 382aa    MW: 42950.6 Da    PI: 6.7757
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_130918g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd ll ++++ +G g+W++ +++ g++R++k+c++rw++yl
   MA_130918g0010 14 KGAWSAEEDSLLGKYIQTHGEGNWRSLPKKAGLRRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.81.7e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+el+++ +++lG++ W+ Ia +++ gRt++++k++w++ 
   MA_130918g0010  67 RGNITADEEELIIRMHALLGNR-WSIIAGRVP-GRTDNEIKNYWNTN 111
                      7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.698961IPR017930Myb domain
SuperFamilySSF466892.66E-2811108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002496.3E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221568IPR009057Homeodomain-like
CDDcd001671.19E-91661No hitNo description
PROSITE profilePS5129423.64662116IPR017930Myb domain
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PfamPF002499.1E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-2369116IPR009057Homeodomain-like
CDDcd001676.07E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGRAPCCAKV GLNKGAWSAE EDSLLGKYIQ THGEGNWRSL PKKAGLRRCG KSCRLRWLNY  60
LRPCIKRGNI TADEEELIIR MHALLGNRWS IIAGRVPGRT DNEIKNYWNT NLSKKLAVRG  120
IDPKTHKKVT TDSINRASDR FNQRKGGKLY DCSQRSQRLE RNVVRAGQST GLVIPNVHNL  180
KADLKGQYIA GPREIQSSNS IRSSSPINTP IQPKSNDFMQ PQPVVSSDAG KQTDDSTVYC  240
SSDSAASCAL IDHLSSEDDD QYLSLEGNSN ECYSHTVAEE SGTLKSSNPQ THSEAICDSR  300
ERDNGGPVQK HDQFPEYDVF SFFDVRNAEN EICCNDDQWV HEQEMPQLHS WDNQIDDQGK  360
EHFGSHVNND VTAMSWEASF WF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU1312210.0KU131221.1 Picea abies transcription factor MYB32 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ409200.0Q40920_PICMA; MYB-like transcriptional factor MBF1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-66myb domain protein 5